Question about D-Link Air DWL 900AP (DWL-900AP) 802.11b Wireless Access Point

1 Answer

Password public not working

I must enter the password public in order toobring the usb configuration utility screen up
but when i enter it it does nothing they say the product has been discontinued do that mean i cant hook it up after i purchased it

Posted by on

Ad

1 Answer

  • Level 2:

    An expert who has achieved level 2 by getting 100 points

    MVP:

    An expert that gotĀ 5 achievements.

    Scholar:

    An expert who has written 20 answers of more than 400 characters.

    Hot-Shot:

    An expert who has answered 20 questions.

  • Expert
  • 66 Answers

HAVE YOU TRIED TO RESET IT? SMALL BUTTON ON BACK BETWEEN ANTENNA AND NETWORK LINE.
YOU MUST SET THE IP ADD CORRECTLY.
YOU OPEN IE OFF LINE AND IN THE ADDRESS LINE TYPE IN THE IP ADD YOU PUT INTO THE DLINK.
A PASSWORD SCREEN DEFAULT WILL SHOW UP
[ USUALLY ADMAN IS THE USER AND ADMAN IS THE PASSWORD DEFAULT

Posted on Dec 27, 2007

Ad

1 Suggested Answer

6ya6ya
  • 2 Answers

SOURCE: I have freestanding Series 8 dishwasher. Lately during the filling cycle water hammer is occurring. How can this be resolved

Hi there,
Save hours of searching online or wasting money on unnecessary repairs by talking to a 6YA Expert who can help you resolve this issue over the phone in a minute or two.

Best thing about this new service is that you are never placed on hold and get to talk to real repairmen in the US.

Here's a link to this great service

Good luck!

Posted on Jan 02, 2017

Ad

Add Your Answer

Uploading: 0%

my-video-file.mp4

Complete. Click "Add" to insert your video. Add

×

Loading...
Loading...

Related Questions:

2 Answers

How to enter boot menu on a lenovo think center M73 computer


This can depend on your OS. For slower booting systems, press and release F12 repeatedly after pressing the power button. Release the button when you see the Choose Boot Device screen. Select the boot device and press Enter. (Note: some systems may not boot from all USB devices or CD/DVDs if they are set for a type of secure boot (UEFI).)

With some systems, you may need to enter the BIOS setup utility to allow the system to boot from a specific device. Try pressing F1 repeatedly after pressing the power button until you hear a lot of beeps or a splash screen. If there is a password for the setup utility, you'll need to enter that password. If you reach the Windows lock screen or the desktop, you missed the timing. Under Windows 10, go to the power icon in the Start menu (on the lower left). Press shift and click Restart. You will see an option for entering the BIOS on restart. Select this and wait. Once in the Setup utility look for the boot menu. You can change the order of the list. Press the correct buttons for save and exit to boot to the desired device.

I hope this helps.

Cindy Wells
(Note: some wireless keyboards may not work in the setup utility. Make sure that a wired keyboard isn't plugged into a USB 3.0 port if you need to load a USB driver to enable the port.)

Aug 07, 2018 | Lenovo Computers & Internet

1 Answer

My kindle says it cannot connect to my wifi even though you can see it is connected on the screen


Does your WiFi network have a password? If so, have you entered the password? You might want to try going to some cafe or public place with free WiFi and see if it will connect there without issue. If so, then you at least know the WiFi works and that it's a configuration issue with your home WiFi.

Sep 21, 2017 | Tablets & eReaders

1 Answer

My satellite Toshiba L875D-s7230 says bootmgr is missing press ctrl alt and delete to restart and does nothing


Which operating you are using?
Method 1: Run Startup Repair from Windows Recovery Environment (WinRE) To run Startup Repair from the Windows Recovery Environment (WinRE), follow these steps:
  1. Insert the Windows installation disc into the disc drive, and then start the computer.
  2. Press a key when the messagePress any key to boot from CD or DVDappears.
    If your PC does not detect the media automatically
    1. During the restart process, read the screen for any instructions that explain how to interrupt normal startup and enter the basic input/output system (BIOS) setup utility. Most PCs use the F2, F10, ESC, or DEL key to begin the BIOS Setup.
    2. Look for a tab in the BIOS Setup Utility that is labeledBoot Order,Boot Options, orBoot. Following the directions on the screen, use the arrow keys to go to theBoot Order, then press Enter.
    3. Locate the CD, DVD, or USB flash drive (this might be called Removable Device) in the Boot list. Following the directions on the screen, use the arrow keys to move the drive up so that it appears first in the Boot list. Press Enter. The boot order sequence is now changed to boot from the CD, DVD, or USB flash drive.
    4. Press F10 to save your changes and to exit the BIOS Setup Utility. SelectYes in the confirmation window. The PC will restart.
  3. Select a language, a time and a currency, a keyboard or input method, and then clickNext.
  4. ClickRepair your computer.
  5. In theSystem Recovery Optionsdialog box, select the drive of your Windows installation, and then clickNext.
  6. At theSystem Recovery Optionsdialog box, clickRepair your computer.
  7. Click the operating system that you want to repair, and then clickNext.
  8. In theSystem Recovery Optionsdialog box, clickStartup Repair.
Method 2: Rebuild the boot configuration data (BCD) from Windows Recovery Environment (WinRE)
  1. Put the Windows installation disc in the disc drive, and then start the computer.
  2. Press a key when the messagePress any key to boot from CD or DVDappears.
    If your PC does not detect the media automatically
    1. During the restart process, read the screen for any instructions that explain how to interrupt normal startup and enter the basic input/output system (BIOS) setup utility. Most PCs use the F2, F10, ESC, or DEL key to begin the BIOS Setup.
    2. Look for a tab in the BIOS Setup Utility that is labeledBoot Order,Boot Options, orBoot. Following the directions on the screen, use the arrow keys to go to theBoot Order, then press Enter.
    3. Locate the CD, DVD, or USB flash drive (this might be called Removable Device) in the Boot list. Following the directions on the screen, use the arrow keys to move the drive up so that it appears first in the Boot list. Press Enter. The boot order sequence is now changed to boot from the CD, DVD, or USB flash drive.
    4. Press F10 to save your changes and to exit the BIOS Setup Utility. SelectYesin the confirmation window. The PC will restart. Allow the PC to restart normally. The scan will take a few minutes and remove any malware that may be infecting your computer.
  3. Select a language, a time, a currency, a keyboard or another input method, and then clickNext.
  4. ClickRepair your computer.
  5. Click the operating system that you want to repair, and then clickNext.
  6. In theSystem Recovery Optionsdialog box, clickCommand Prompt.
  7. TypeBootrec /RebuildBcd, and then pressENTER.


Jan 20, 2017 | Toshiba Computers & Internet

1 Answer

How do i set up td-w8968


Configuring the PC

After you directly connect your PC to the modem router or connect your adapter to a Hub/Switch which has connected to the modem router, you need to configure your PC's IP address. Follow the steps below to configure it.

Step 1: Click the Start menu on your desktop, right click My Network Places, and then select Properties (shown in Figure 3-1).

2q==

Figure 3-1

Step 2: Right click Local Area Connection (LAN), and then select Properties.





swdfx3buhbuq8vtnw4buabext2fny6dn2yb3j8q11lqaa7caob5uowhnnroyklp8j49rogds1dhcra0pr2tkhnrwpxy9rwuva1si2takep29ra9ra4za1ud8vb3sawtr4nrnchs9zi6jyqads=Figure 3-2

Step 3: Select General tab, highlight Internet Protocol (TCP/IP), and then click the Properties button.

z

Figure 3-3

11

TD-W8968 300Mbps Wireless N USB ADSL2+ Modem Router User Guide Step 4: Configure the IP address as Figure 3-4 shows. After that, click OK.

2q==

Figure 3-4

IV' Note:

You can configure the PC to get an IP address automatically, select "Obtain an IP address automatically" and "Obtain DNS server address automatically" in the screen above.

Now, you can run the Ping command in the command prompt to verify the network connection. Please click the Start menu on your desktop, select run tab, type cmd or command in the field and press Enter. Type ping 192.168.1.1 on the next screen, and then press Enter.

If the result displayed is similar to the screen below, the connection between your PC and the modem router has been established.

z

Figure 3-5

12

i6omp5ex15+rw8zpt9gfv8vj5wpx8vvf6aaou6udwyj+bcbnckcjqlmkhemu0nmjjymslggvq3jjbwglgjydhcbxjwwpikyg9kfyzjqxllypyymxgeqznhtnzgqh5sydantn5+hwad6hmakstnizatkntp1cjsp1ktarvq1izat3k9aoapwddih1ltqzzs2hpjgaaow==w858adahab0rqghr0oahnqeixslaemvshei2orcdk0ypa9kimdshgn8rrjnr0oxunaga7kjv1gqiaow==If the result displayed is similar to the screen shown below, it means that your PC has not connected to the modem router.

2q==

Figure 3-6

You can check it following the steps below:

1) Is the connection between your PC and the modem router correct?

The LEDs of LAN port which you link to the device and the LEDs on your PC's adapter should be lit.

2) Is the TCP/IP configuration for your PC correct?

If the Router's IP address is 192.168.1.1, your PC's IP address must be within the range of 192.168.1.2 ~ 192.168.1.254.

3.2 Quick Installation Guide

With a Web-based utility, it is easy to configure and manage the TD-W8968 300Mbps Wireless N USB ADSL2+ Modem Router. The Web-based utility can be used on any Windows, Macintosh or UNIX OS with a Web browser, such as Microsoft Internet Explorer, Mozilla Firefox or Apple Safari.

1. To access the configuration utility, open a web-browser and type the default address http://192.168.1.1 in the address field of the browser.

z

Figure 3-7

After a moment, a login window will appear, similar to the Figure 3-8. Enter admin for the User Name and Password, both in lower case letters. Then click the OK button or press the Enter key.

mfvwnrkduldggaow==w858adahab0rqghr0oahnqeixslaemvshei2orcdk0ypa9kimdshgn8rrjnr0oxunaga7bgeabherbheibhezbhfebhfvbhfmbhf3bhgibhgzbhgqbhg7bhhmbhha7hgaaaow==



png;base64,r0lgodlhhwauahcamsh+glnvznr3yxjloibnawnyb3nvznqgt2zmawnlach5baeaaaaalamabqaqaaoahaaaaaaaaagdaaqidq0kcamaawgkdq0lcwaaawsgawadbaqdaamebasgcaoldqmdcaskcagdawmgcwsldqecawecawecawecawecawecawecawecawecawecawecawecawvaiaacwiceileyihmy6cggbbioc4wmzao0dpiu9yd4wixuiwjqszddhatgpalphmeeeptpbifwghancz9e8xkqaga7Figure 3-8

(V' Note:

  1. Do not mix up the user name and password with your ADSL account user name and password which are needed for PPP connections.

  2. If the above screen does not pop up, it means that your Web-browser has been set to a proxy. Go to Tools menu-Internet Options-Connections-LAN Settings, in the screen that appears, cancel the Using Proxy checkbox, and click OK to finish it.

Aug 19, 2014 | TP-Link Technologies TP-LINK TD-W8968 -...

1 Answer

Forgotten my password


Restart your computer repeatedly tapping the f8 key to enter safe mode while the screen is black once in safe mode where the only things working will be your keyboard and mouse allowing you to attempt to repair your computer
Windows Advanced Options Menu
Please select an option:
Safe Mode
Safe Mode with Networking
Safe Mode with Command Prompt
Enable Boot Logging
Enable VGA mode
Last Known Good Configuration (your most recent settings that worked)
Directory Services Restore Mode (Windows domain controllers only)
Debugging Mode
Start Windows Normally
Reboot
Return to OS Choices Menu
Use the up and down arrow keys to move the highlight to your choice
select safe mode with command prompt
Click start run type cmd press Enter
black screen should open DOS mode
this will vary depending on your operating system
type in net user username
For eg. If you want to change administrator password , type net user Administrator
It will prompt you to enter the new password.
Enter the new password and the password is changed
http://wiki.ljackson.us/Control_Userpasswords2
if this fails you will need to
Select safe mode with networking to download
you could download all of these or just one save them to a usb drive for later use if one fails to remove the password
Windows Password Recovery Basic
http://majorgeeks.com/CmosPwd_d239.html
A CMOS BIOS password recovery tool
Editors note: This tool should only be used by experienced computer users.
Please see the enclosed read me if you would like to run it from Windows.
Failure to follow instructions (from Windows) will cause your anti-virus to flag this as a virus.
http://majorgeeks.com/Dr._Freeware_System_Utilities_d6416.html Dr.Freeware System Utilities which includes data recovery software, data backup, password reset tools for Windows helps you to maintain your system. Dr.Freeware is freeware, you can download and use it for free.

Oct 02, 2013 | AccessData Password Recovery Tool Kit (ftk...

1 Answer

Forgot My Pin Number. how do retrieve it .


Hola Sorry to say but if this is the right one i searched for the manual found
http://download.lenovo.com/UserFiles/UserGuide/en/User's%20guides%20and%20manuals/K1/Lenovo%20IdeaPad%20Tablet%20K1%20Hardware%20Maintenance%20Manual.pdf
IT said as following:

As many as two passwords may be needed for any Lenovo IdeaPad computer: the power-on password (POP) and the supervisor password (SVP). If any of these passwords has been set, a prompt for it appears on the screen whenever the computer is turned on. The computer does not start until the password is entered.

Exception: If only an SVP is installed, the password prompt does not appear when the operating system is booted.

Power-on password

A power-on password (POP) protects the system from being powered on by an unauthorized person. The password must be entered before an operating system can be booted.

Supervisor password

A supervisor password (SVP) protects the system information stored in the BIOS Setup Utility. The user must enter the SVP in order to get access to the BIOS Setup Utility and change the system configuration.

Attention: If the SVP has been forgotten and cannot be made available to the servicer, there is no service procedure to reset the password. The system board must be replaced for a scheduled fee.



Sorry hope this helps a little good luck

May 10, 2013 | Lenovo IdeaPad Tablet K1

1 Answer

I want to have a new password


Restart your computer repeatedly tapping the f8 key to enter safe mode while the screen is black once in safe mode where the only things working will be your keyboard and mouse allowing you to attempt to repair your computer Windows Advanced Options Menu Please select an option: Safe Mode
Safe Mode with Networking
Safe Mode with Command Prompt Enable Boot Logging
Enable VGA mode
Last Known Good Configuration (your most recent settings that worked)
Directory Services Restore Mode (Windows domain controllers only)
Debugging Mode Start Windows Normally
Reboot
Return to OS Choices Menu Use the up and down arrow keys to move the highlight to your choice select safe mode with command prompt Click start run type cmd press Enter black screen should open DOS mode this will vary depending on your operating system type in net user username For eg. If you want to change administrator password , type net user Administrator It will prompt you to enter the new password. Enter the new password and the password is changed if this fails you will need to Select safe mode with networking to download you could download all of these or just one save them to a usb drive for later use if one fails to remove the password Windows Password Recovery Basic http://majorgeeks.com/CmosPwd_d239.html A CMOS BIOS password recovery tool Editors note: This tool should only be used by experienced computer users. Please see the enclosed read me if you would like to run it from Windows. Failure to follow instructions (from Windows) will cause your anti-virus to flag this as a virus. http://majorgeeks.com/Dr._Freeware_System_Utilities_d6416.html Dr.Freeware System Utilities which includes data recovery software, data backup, password reset tools for Windows helps you to maintain your system. Dr.Freeware is freeware, you can download and use it for free. Hope this helps.

Dec 12, 2012 | AccessData Password Recovery Tool Kit (ftk...

2 Answers

How to enter bios on thinkcentre 8811-6cu


Try hitting F2 when boot starts will normally take you to the bios.

Jun 14, 2011 | Lenovo ThinkCentreĀ® M55-8811 PC Desktop

1 Answer

1. My ideapad Y430 easy cam doesnot working after i reinstall windows vista ultimate. Not i cant use it for my password. 2. I also try to partition it into four but it doesnot support i can have only two...


this is all I can offer in your situation.....one option is to..use the...
Novo button
This button functions as a reset button; use with caution. Press the
1. Novo button to enter the main interface of OneKey Recovery while the
power is off. You can use OneKey Recovery to restore the primary
hard disk partition (usually drive C) back to the factory default
configuration, including the operating system and the software on it.
Attention: Once done, the system can no longer return to its previous
state. All data on the primary hard disk partition (usually
drive C) will subsequently be lost. So make sure all
important files on the primary hard disk partition have
been backed up onto another hard disk or USB hard disk
drive before this operation.
For details, see “OneKey Recovery4.65 User Guide

2. For the camera check out these key functions....

The following describes the features of each function key.
Fn + Esc: Turn on/off the integrated camera.
Fn + F1: Put your computer in sleep mode.
Fn + F2: Turn off the LCD screen (any subsequent operation will turn the LCD screen back on).
Fn + F3: Shift to other connected display devices.
Fn + F4: Switch between wide screen and normal mode.
Fn + F5: Enable/disable the built-in wireless networking feature.
Fn + F6: Enable/disable the bluetooth features.
Fn + F8: Enable/disable the touch pad.
Fn + F9: Enable/pause Media Player playback.
Fn + F10: Stop Media Player playback.
Fn + F11: Skip to the previous track.
Fn + F12: Skip to the next track.
Fn + Insert/NmLk: Enable/disable the Numeric keypad.
Fn + Delete/ScrLk: Enable/disable Scroll Lock.
Fn + Pause/Break: Pause to view the system information during start-up.
Fn + up/down arrow key: Increase/decrease display brightness.
Fn + right/left arrow key: Increase/decrease computer volume.

3. And for the password...here you go....

Using Passwords
Using passwords helps prevent your computer from being used by others.
Once you set a password and enable it, a prompt appears on the screen each time you power on the computer. Enter your password at the prompt. You cannot use the computer unless you type the correct password.
Make sure that only authorized individuals access your computer.
Establishing different kinds of passwords requires that other possible users know the proper passwords in order to access your computer or your data.
As many as three passwords might be needed for your computer: the Supervisor password, the User Password, and the hard-disk drive (HDD) password. When the Supervisor password is set, only the Supervisor password entitles you full control of the computer.
• User password
If a user password is set and Password on boot is enabled, a password prompt appears when you turn on the computer. Unauthorized users cannot get access to configuration data.
You can also use the user password to enter the BIOS Setup Utility, but once the Supervisor password is set only a part of the options can be set.
• Supervisor password
With a Supervisor password, you can get full control of the computer. It also can be used as a power-on password, the same as the User password. Also, when you enter the BIOS Setup Utility with a Supervisor password, you are entitled to set all of the options.
• Hard disk (HDD) passwords
Once an HDD password is set, you need to enter it to get access to the hard disk. You can set the HDD password through either the User Only selection or the User + Master selection in the BIOS Setup Utility.
Note: If you set passwords through the BIOS Setup Utility and you put your computer into sleep mode by pressing Fn + F1, the following describes the behavior of the computer when you bring it out of sleep mode:
• You are prompted to type the Windows log-on password rather
than the User password to resume operation.
• If an HDD password is assigned to any hard disk drive, the hard
disk drive is unlocked automatically when you resume operation.
To set a User Password:
1. Turn on your computer. Press F2, while the initial screen is displayed.
The BIOS Setup Utility screen opens.
2. Select Security, using the cursor directional keys.
3. Select Set User Password, and press the Enter key. The Set User Password window opens.
4. Choose your user password, which can be from one to eight
alphanumeric characters in any combination. Type it in the Enter New Password field.
5. Press the Enter key once to move to the Confirm New Password field. Retype the password you just entered to verify it.
6. Commit your password to memory, and press the Enter key.
7. Press F10 to exit.
8. Select Yes in the Setup Confirmation window.
Changing or Removing the User Password
To change the password, do the following:
1. In the Enter Current Password field, type your current password.
2. In the Enter New Password field, type a new password; then retype it to verify.
To remove the password, do the following:
1. In the Enter Current Password field, type your current password.
2. Leave the Enter New Password field blank, and then press the Enter key twice.
Note: Make sure the Password on boot is set to Enabled if you need the password protection at power on.
To set a Supervisor Password:
Only a system administrator will be able to perform this procedure.
1. Turn on your computer. Press F2, while the initial screen is displayed.
The BIOS Setup Utility screen opens.
2. Select Security using the cursor directional keys.
3. Select Set Supervisor Password, and press the Enter key. The Set Supervisor Password window opens.
4. Choose your supervisor password; it can be from one to eight
alphanumeric characters in any combination. Type it in the Enter New Password field.
5. Press the Enter key to move to the Confirm New Password field.
Retype the password you just entered to verify it.
6. Commit your password to memory, and press the Enter key.
Attention: You might want to note your password and keep it in a
safe place. If you forget your supervisor password,
Lenovo can not reset your password. You must take your
computer to a Lenovo reseller or a Lenovo marketing
representative to solve this problem. Proof of purchase is
required, and a fee will be charged for parts and service.
7. Press F10 to exit.
8. Select Yes in the Setup Confirmation window.
The next time you open the BIOS Setup Utility program, you will be prompted to type your password to proceed.
Changing or Removing the Supervisor Password
To change the password, do the following:
1. In the Enter Current Password field, type the current supervisor
password.
2. In the Enter New Password field, type the new supervisor password; then retype it to verify.
To remove the password, do the following:
1. In the Enter Current Password field, type the current supervisor
password.
2. Leave the Enter New Password field blank, and then press the Enter key twice.
Hard Disk Passwords
Two types of the hard disk passwords help protect the information stored on the hard disk:
• Hard disk user password
• Hard disk master password, which requires a hard disk user password If User only is selected and a hard disk user password has been set, but no hard disk master password has been set, the user must enter the hard disk user password in order to gain access to files and applications on the hard disk.
If User + Master is selected you need to set a master password and a user password both as the Hard Disk Password. Either of the two passwords can be used to get access to the Hard disk. Any change or removal to the master password deletes the user password.
To set a hard disk password:
Print these instructions.
1. Turn on your computer. Press F2, while the initial screen is displayed.
The BIOS Setup Utility screen opens.
2. Select Security, using the cursor directional keys.
3. Select Built-in HDD1 Password Select, and press the Enter key. A window for selecting User Only or User + Master opens.
I will send the rest in the comment section..hope this helps in some way...the Fang.

Mar 07, 2009 | Lenovo 3000 Y410 Notebook

Not finding what you are looking for?
D-Link Air DWL 900AP (DWL-900AP) 802.11b Wireless Access Point Logo

Related Topics:

143 people viewed this question

Ask a Question

Usually answered in minutes!

Top D-Link Computers & Internet Experts

Prashant M
Prashant M

Level 3 Expert

2268 Answers

Les Dickinson
Les Dickinson

Level 3 Expert

18425 Answers

Michael Galve
Michael Galve

Level 3 Expert

1269 Answers

Are you a D-Link Computer and Internet Expert? Answer questions, earn points and help others

Answer questions

Manuals & User Guides

Loading...