Question about Computers & Internet

1 Answer

TP Link Nano 702

After setting up the IP address in the local area connection, the next step that is opening the web management page(the green tab page) of the TP link not opening!! So not able to go any further. TP link manual says type address 192.169.0.254, but in internet explorer it says cant find the page you are looking for!!

Posted by on

  • Anonymous Mar 18, 2014

    Type and select from what list?

×

Ad

1 Answer

  • Level 3:

    An expert who has achieved level 3 by getting 1000 points

    Superstar:

    An expert that got 20 achievements.

    All-Star:

    An expert that got 10 achievements.

    MVP:

    An expert that got 5 achievements.

  • Master
  • 2,072 Answers

An address that starts with 192.169 is not a private address. It should start with 10.x.x.x or 172.16.x.x or in your case it should start with 192.168.x.x

Posted on Dec 02, 2012

Ad

6 Suggested Answers

6ya6ya
  • 2 Answers

SOURCE: I have freestanding Series 8 dishwasher. Lately during the filling cycle water hammer is occurring. How can this be resolved

Hi,
a 6ya expert can help you resolve that issue over the phone in a minute or two.
best thing about this new service is that you are never placed on hold and get to talk to real repairmen in the US.
the service is completely free and covers almost anything you can think of (from cars to computers, handyman, and even drones).
click here to download the app (for users in the US for now) and get all the help you need.
goodluck!

Posted on Jan 02, 2017

Ad
crapiemael
  • 241 Answers

SOURCE: After replacing Cable Modem, D-Link DI-524 Wireless will not work

Did you call Comcast and give them the new MAC address of the Motorola SB5101 SURFboard cable modem? I'm surpised it works at all without doing this first. This is the hardware address of your modem so the world can see you, no one in the world has the same MAC address, they are all different. It's on a sticker on the modem.

Posted on May 28, 2009

shaky120
  • 310 Answers

SOURCE: How to set a static IP address in Windows behind a Linksys Router

Sorry mate but you have kinda lost me here, if you need a static IP address for the internet you need to contact you isp and they will provide you one, if you want to set your machine to set IP Address just go into properties for local network connection and use somthing like 192.168.1.1 255.255.255.0 and leave the dns to obtain. but you wont be able to set a internet static ip address by doing this, only way is to contact your isp.. All the best John

Posted on Mar 08, 2007

  • 556 Answers

SOURCE: I cant open an ip address for an assigned webpage.

There are several private address ranges that may be affecting the operations you are attempting to perform see table

IP Address Ranges Reserved for Private Use
Class Networks A 10.0.0.0 through 10.255.255.255 B 172.16.0.0 through 172.31.0.0 C 192.168.0.0 through 192.168.255.0
All addresses in this range in your network are only directly addressable to machines within your network at most by default. The router to your ISP and the internet as a whole maps these addresses onto the IP address assigned statically or dynamically by your ISP to the WAN side of your router using an address translation (NAT) service. So where you are attempting to connect to this device from may be significant. You may need to review your setup guide to see if it references router configuration requirements to support access to the Web_xpander port from devices not attached to your internal network. If you have multiple internal networks (address ranges and not devices) this could also be an issue.

Secondly -- does the Setup software for the device tell you the IP address assuming it is dynamically assigned. Otherwise how would you know what the address is. Static assignment could resolve that issue however you must understand your network to assign your own address. Given a theoretical network where the router gateway is 192.169.0.1 and the network mask is 255.255.255.0 the valid network addresses are 192.168.1.0 - 192.168.1.255. A router or other device supporting DHCP address assignment reserves another range such as 192.168.0.100 for 50 leases (ending at 192.168.0.149) for dynamic assignment to requesting network adapters. Ignoring the 0 and 255 address this leaves open to the network administrator (you in your home) the possibility of assigning static IP address in the ranges of say 192.168.0.2 - 192.168.0.99 and 192.168.0.150 - 192.168.0.254 or so. You as well as the DHCP server are required to assure that there are no duplicate IP addresses assigned on your network. So statically assigning 192.168.0.100 (which is DHCP assignable in our case) could and would most likely result in duplicate addressing and network problems.

Posted on Dec 08, 2007

govinda123
  • 2260 Answers

SOURCE: cant access internet but can connect to wireless TP-link router

Your friend is able to go online using the same wireless network. that means the wireless network is working properly and there might be a problem with your computer .
You said that you can connect to the wireless network but you can not go online.
Check the IP address and the default gateway of the computer.
Try to ping the router and DNS server and check what happens.
Make sure that there is no static IP address on the computer.

Click Here for more information about the routers and Internet.

Posted on Feb 01, 2010

jhoeldorz
  • 169 Answers

SOURCE: No internet on PC when cables going through router

Hello there,

You have to start from the beginning and my solution would be:

1) Remove any connections(also don't forget to turn of wifi on your laptop) to router and except the power cord. With the unit powered ON locate the reset pinhole on the back of router.

2) Press and hold reset button for at least 15 secs. then release, wait for 20-30 secs. before the router can completely rebooted.

3) Configure your Computer IP address to “Obtain an IP address automatically” .

4) Connect internet cable to router on port labeled "WAN". Connect PC to any LAN ports available.

5) Now lets configure wireless router. Open any browser you have (IE, Firefox, Chrome, Safari, etc.). On the address bar type: "192.168.1.1" (without quotes). Default username: admin ; default password: admin click "OK".

6) Go through "SETUP WIZARD" until you reach the "Setup WAN Interface" page. On "WAN Access Type:" select "DHCP" then click next.

7) You may configure your "Basic Wireless Settings" to Public or Private until finished configuring.

8) On "Operation Mode" be sure you operate on "Gateway" mode.

That's it! Hope this helps.

Don't forget to vote.

Posted on Mar 12, 2010

Add Your Answer

Uploading: 0%

my-video-file.mp4

Complete. Click "Add" to insert your video. Add

×

Loading...
Loading...

Related Questions:

2 Answers

How to set up my router with modem?


Connect the router to the modem with an ethernet cable, CAT 5, 6 or 7. Try amazon.

Jul 19, 2016 | TP-LINK Computers & Internet

1 Answer

How do i set up td-w8968


Configuring the PC

After you directly connect your PC to the modem router or connect your adapter to a Hub/Switch which has connected to the modem router, you need to configure your PC's IP address. Follow the steps below to configure it.

Step 1: Click the Start menu on your desktop, right click My Network Places, and then select Properties (shown in Figure 3-1).

2q==

Figure 3-1

Step 2: Right click Local Area Connection (LAN), and then select Properties.





swdfx3buhbuq8vtnw4buabext2fny6dn2yb3j8q11lqaa7caob5uowhnnroyklp8j49rogds1dhcra0pr2tkhnrwpxy9rwuva1si2takep29ra9ra4za1ud8vb3sawtr4nrnchs9zi6jyqads=Figure 3-2

Step 3: Select General tab, highlight Internet Protocol (TCP/IP), and then click the Properties button.

z

Figure 3-3

11

TD-W8968 300Mbps Wireless N USB ADSL2+ Modem Router User Guide Step 4: Configure the IP address as Figure 3-4 shows. After that, click OK.

2q==

Figure 3-4

IV' Note:

You can configure the PC to get an IP address automatically, select "Obtain an IP address automatically" and "Obtain DNS server address automatically" in the screen above.

Now, you can run the Ping command in the command prompt to verify the network connection. Please click the Start menu on your desktop, select run tab, type cmd or command in the field and press Enter. Type ping 192.168.1.1 on the next screen, and then press Enter.

If the result displayed is similar to the screen below, the connection between your PC and the modem router has been established.

z

Figure 3-5

12

i6omp5ex15+rw8zpt9gfv8vj5wpx8vvf6aaou6udwyj+bcbnckcjqlmkhemu0nmjjymslggvq3jjbwglgjydhcbxjwwpikyg9kfyzjqxllypyymxgeqznhtnzgqh5sydantn5+hwad6hmakstnizatkntp1cjsp1ktarvq1izat3k9aoapwddih1ltqzzs2hpjgaaow==w858adahab0rqghr0oahnqeixslaemvshei2orcdk0ypa9kimdshgn8rrjnr0oxunaga7kjv1gqiaow==If the result displayed is similar to the screen shown below, it means that your PC has not connected to the modem router.

2q==

Figure 3-6

You can check it following the steps below:

1) Is the connection between your PC and the modem router correct?

The LEDs of LAN port which you link to the device and the LEDs on your PC's adapter should be lit.

2) Is the TCP/IP configuration for your PC correct?

If the Router's IP address is 192.168.1.1, your PC's IP address must be within the range of 192.168.1.2 ~ 192.168.1.254.

3.2 Quick Installation Guide

With a Web-based utility, it is easy to configure and manage the TD-W8968 300Mbps Wireless N USB ADSL2+ Modem Router. The Web-based utility can be used on any Windows, Macintosh or UNIX OS with a Web browser, such as Microsoft Internet Explorer, Mozilla Firefox or Apple Safari.

1. To access the configuration utility, open a web-browser and type the default address http://192.168.1.1 in the address field of the browser.

z

Figure 3-7

After a moment, a login window will appear, similar to the Figure 3-8. Enter admin for the User Name and Password, both in lower case letters. Then click the OK button or press the Enter key.

mfvwnrkduldggaow==w858adahab0rqghr0oahnqeixslaemvshei2orcdk0ypa9kimdshgn8rrjnr0oxunaga7bgeabherbheibhezbhfebhfvbhfmbhf3bhgibhgzbhgqbhg7bhhmbhha7hgaaaow==



png;base64,r0lgodlhhwauahcamsh+glnvznr3yxjloibnawnyb3nvznqgt2zmawnlach5baeaaaaalamabqaqaaoahaaaaaaaaagdaaqidq0kcamaawgkdq0lcwaaawsgawadbaqdaamebasgcaoldqmdcaskcagdawmgcwsldqecawecawecawecawecawecawecawecawecawecawecawecawvaiaacwiceileyihmy6cggbbioc4wmzao0dpiu9yd4wixuiwjqszddhatgpalphmeeeptpbifwghancz9e8xkqaga7Figure 3-8

(V' Note:

  1. Do not mix up the user name and password with your ADSL account user name and password which are needed for PPP connections.

  2. If the above screen does not pop up, it means that your Web-browser has been set to a proxy. Go to Tools menu-Internet Options-Connections-LAN Settings, in the screen that appears, cancel the Using Proxy checkbox, and click OK to finish it.

Aug 19, 2014 | TP-Link Technologies TP-LINK TD-W8968 -...

1 Answer

TL-WR940N


Hello
I can give some details on port forwarding for TL-WR940n. You could follow this procedure given below. here is the link too. http://www.tp-link.com/en/article/?id=72




How do I open ports on my TP-LINK wireless Router?


Suitable for: 300Mbps Wireless N Routers, 150Mbps Wireless N Routers, 54Mbps Wireless G Routers


Step 1 Open the web browser and type the IP address of the router (default is 192.168.1.1 or 192.168.0.1) into the address bar and then Press Enter.

Step 2 Type the username and password in the login page, the default username and password both are admin.

Step 3 Click Forwarding->Virtual Servers on the left side, and then click Add New... button.




Step 4 Type the Service port which you want to open and the IP Address of your computer; Select Protocol to TCP, UDP or ALL; Change Status to Enabled




Step 5 Click Save button to save the settings.

Note:
If you want to open port 80 for Web server in your computer, the Management port of the router will be changed to 8080, you need to type Http://192.168.1.1:8080 to connect to you router.




TP-Link_SupportForce
TP-Link USA Corporation
Tel: +1 866-225-8139
E-Mail: steve.crow@tp-link.com
Website: www.tp-link.com/en/support/index.asp

Jun 08, 2012 | TP-LINK TPLink Tp link Tl wr940n 300mbps...

1 Answer

I'm plugged in all the cable correctly (based on the manual) when i got to the 6th step when we have to make sure all the lights are flashing, the WAN lights is on but the light is in ORANGE color, i...


Step 1 Verify physical connectivity by checking for solid link lights on the device. If you do not get a solid link light, try using a different cable or connect to a different port on the device if possible. If the computer is turned off, the link light may not be on.

Step 2 Disable any internet security software running on the computer. Software firewalls like Zone Alarm, Black Ice, Sygate, Norton Personal Firewall, etc. might block access to the configuration pages. Check the help files included with your firewall software for more information on disabling or configuring it. Note that in some cases just disabling the firewall/antivirus software may not help, you may need to uninstall and reinstall the software.

Step 3 Configure your internet settings. Go to Start > Settings > Control Panel. Double click the Internet Options Icon. From the Security tab, click the button to restore the settings to their defaults. Click to the Connection tab and set the dial-up option to Never Dial a Connection. Click the LAN Settings button. Nothing should be checked. Click OK. Go to the Advanced tab and click the button to restore these settings to their defaults. Click OK out to the desktop and close any open windows.

Step 4 Check your IP address. Your computer must have an IP address in the same range of the device you are attempting to configure. Most D-Link devices use the 192.168.0.x range.

If you are attempting to configure a D-Link router, then make sure you take note of your computers Default Gateway IP address. The Default Gateway is the IP address of the D-Link router. By default, it should be 192.168.0.1.

If you are attempting to configure an Access Point or Print Server, you may need to configure your computer with a Static IP Address in the appropriate range.

To set your computer with static IP address:
Windows2000/XP: Control Panel > Network Connections > Local Area Connection > Properties > Internet protocol TCP/IP > Properties...
Windows95/98/ME: Control Panel > Network > TCP/IP protocol for your Network Adapter > Properties...

IP address: 192.168.0.2
Subnet mask: 255.255.255.0
Gateway: 192.168.0.1
DNS: 202.129.64.198 (or whichever your provider is using)

Step 5 Access the web management. Open your web browser and enter the IP address of your D-Link device in the address bar. This should open the login page for your the web management. Use the instructions provided with your product to login and complete the configuration. There are several more FAQs that cover the configuration of the different D-Link Gateways, Access Points and Print Servers.

I got this from their support page. Hope this works out for you :D

Jul 18, 2011 | D-Link Wireless N 150 Home Router 4Port...

1 Answer

IP Address


Step 1 Open your web browser and type the IP address of the wireless router in the address bar (default is 192.168.0.1). Press Enter. Step 2 The default username is admin and the password is blank (nothing). Click OK. Step 3 Click on the Home tab then click LAN to the left. Step 4 Next to IP Address enter the new IP address. Next to Subnet Mask enter the correct subnet mask for the IP address entered. Enter a Local Domain Name if applicable. Step 5 Click Apply and then click Continue to save the settings.

Feb 16, 2006 | D-Link Air Xpert DI-774 Wireless Router

1 Answer

IP Address


Step 1 Open your web browser and type the IP address of the wireless router in the address bar (default is 192.168.0.1). Press Enter. Step 2 The default username is admin and the password is blank (nothing). Click OK. Step 3 Click on the Home tab then click LAN to the left. Step 4 Next to IP Address enter the new IP address. Next to Subnet Mask enter the correct subnet mask for the IP address entered. Enter a Local Domain Name if applicable. Step 5 Click Apply and then click Continue to save the settings.

Feb 16, 2006 | D-Link Air Xpert DI-774 (DWL-774) Wireless...

3 Answers

Access configuration


Step 1 Verify physical connectivity by checking for solid link lights on the device. If you do not get a solid link light, try using a different cable or connect to a different port on the device if possible. If the computer is turned off, the link light may not be on. Step 2 Disable any internet security software running on the computer. Software firewalls such as Zone Alarm, Black Ice, Sygate, Norton Personal Firewall, and Windows XP firewall may block access to the configuration pages. Check the help files included with your firewall software for more information on disabling or configuring it. Step 3 Configure your Internet settings. Go to Start > Settings > Control Panel. Double-click the Internet Options Icon. From the Security tab, click the button to restore the settings to their defaults. Click the Connection tab and set the dial-up option to Never Dial a Connection. Click the LAN Settings button. Nothing should be checked. Click OK. Go to the Advanced tab and click the button to restore these settings to their defaults. Click OK out to the desktop and close any open windows. Step 4 Check your IP address. Your computer must have an IP address in the same range of the device you are attempting to configure. Most D-Link devices use the 192.168.0.X range. Click here to find your IP Address on your computer If you are attempting to configure a D-Link router, then make sure you take note of your computer´s Default Gateway IP address. The Default Gateway is the IP address of the D-Link router. By default, it should be 192.168.0.1. If you are attempting to configure an Access Point or Print Server, you may need to configure your computer with a Static IP Address in the appropriate range. Step 5 Access the web management. Open your web browser and enter the IP address of your D-Link device in the address bar. This should open the login page for your the web management. Use the instructions provided with your product to login and complete the configuration.

Feb 16, 2006 | D-Link AirPlus DI-614+ Wireless Router

1 Answer

How do I use the Remote Management feature on my router?


Remote Management allows the device to be configured through the WAN (Wide Area Network) port from the Internet using a web browser. Step 1 Log into the web based configuration of the router by typing in the IP address of the router (default:192.168.0.1) in your web browser. The username is admin (all lowercase) and the password is blank (nothing). Step 2 Click the Tools tab and click the Admin button. Step 3 Select the Enabled button to enable Remote Management. In the IP Address field type in the public IP address you wish to manage the router. Note: If you don´t know the IP address or wish to allow more than one IP address to manage the router then put an asterisk (*) in the IP Address field. You cannot enter an IP range. Step 4 By default the port used to Remote Manage the router is set to 8080. Change the port number by selecting the down arrow next to the Port Number drop down menu. Step 5 Click on Apply and then click Continue to save the changes. To Remote Manage the router you will need to type in the Public IP Address of the router in your web browser along with the Port Number (separated by a colon) you selected in Step 4.

Feb 16, 2006 | D-Link Express EtherNetwork DI-604 Router

1 Answer

IP Address


Step 1 Open your web browser and type the IP address of the wireless router in the address bar (default is 192.168.0.1). Press Enter. Step 2 The default username is admin and the password is blank (nothing). Click OK. Step 3 Click on the Home tab then click LAN to the left. Step 4 Next to IP Address enter the new IP address. Next to Subnet Mask enter the correct subnet mask for the IP address entered. Enter a Local Domain Name if applicable. Step 5 Click Apply and then click Continue to save the settings.

Feb 16, 2006 | D-Link Express EtherNetwork DI-604 Router

1 Answer

Can´t I access the web-based configuration


Step 1 Verify physical connectivity by checking for solid link lights on the device. If you do not get a solid link light, try using a different cable or connect to a different port on the device if possible. If the computer is turned off, the link light may not be on. Step 2 Disable any internet security software running on the computer. Software firewalls such as Zone Alarm, Black Ice, Sygate, Norton Personal Firewall, and Windows XP firewall may block access to the configuration pages. Check the help files included with your firewall software for more information on disabling or configuring it. Step 3 Configure your Internet settings. Go to Start > Settings > Control Panel. Double-click the Internet Options Icon. From the Security tab, click the button to restore the settings to their defaults. Click the Connection tab and set the dial-up option to Never Dial a Connection. Click the LAN Settings button. Nothing should be checked. Click OK. Go to the Advanced tab and click the button to restore these settings to their defaults. Click OK out to the desktop and close any open windows. Step 4 Check your IP address. Your computer must have an IP address in the same range of the device you are attempting to configure. Most D-Link devices use the 192.168.0.X range. Click here to find your IP Address on your computer If you are attempting to configure a D-Link router, then make sure you take note of your computer´s Default Gateway IP address. The Default Gateway is the IP address of the D-Link router. By default, it should be 192.168.0.1. If you are attempting to configure an Access Point or Print Server, you may need to configure your computer with a Static IP Address in the appropriate range. Step 5 Access the web management. Open your web browser and enter the IP address of your D-Link device in the address bar. This should open the login page for your the web management. Use the instructions provided with your product to login and complete the configuration.

Feb 16, 2006 | D-Link Express EtherNetwork DI-604 Router

Not finding what you are looking for?
Computers & Internet Logo

Related Topics:

65 people viewed this question

Ask a Question

Usually answered in minutes!

Top Computers & Internet Experts

Doctor PC
Doctor PC

Level 3 Expert

7733 Answers

kakima

Level 3 Expert

102366 Answers

David Payne
David Payne

Level 3 Expert

14161 Answers

Are you a Computer and Internet Expert? Answer questions, earn points and help others

Answer questions

Manuals & User Guides

Loading...